Lineage for d1c5bh1 (1c5b H:1-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7307Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [48903] (2 PDB entries)
  8. 7310Domain d1c5bh1: 1c5b H:1-113 [20477]
    Other proteins in same PDB: d1c5bh2, d1c5bl2

Details for d1c5bh1

PDB Entry: 1c5b (more details), 2.1 Å

PDB Description: decarboxylase catalytic antibody 21d8 unliganded form

SCOP Domain Sequences for d1c5bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5bh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)}
qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvss

SCOP Domain Coordinates for d1c5bh1:

Click to download the PDB-style file with coordinates for d1c5bh1.
(The format of our PDB-style files is described here.)

Timeline for d1c5bh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c5bh2