SCOPe 2.08: Domain d2gdrc1: 2gdr C:1-80

Lineage for d2gdrc1 (2gdr C:1-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [225115] (2 PDB entries)

8. Domain d2gdrc1: 2gdr C:1-80 [204341]
   Other proteins in same PDB: d2gdra2, d2gdrb2, d2gdrc2, d2gdrd2, d2gdre2, d2gdrf2
   automated match to d1n2aa2
   complexed with gsh

Details for d2gdrc1

PDB Entry: 2gdr, 2.1 Å

PDB Description: Crystal structure of a bacterial glutathione transferase

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d2gdrc1:

Sequence; same for both SEQRES and ATOM records:

>d2gdrc1 c.47.1.0 (C:1-80) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mklyyspgacslsphialreaglnfelvqvdlaskktasgqdylevnpagyvpclqlddg
rtltegpaivqyvadqvpgk

Timeline for d2gdrc1:

• d2gdrc1 first appeared in SCOPe 2.03
  
• d2gdrc1 appears in SCOPe 2.07