SCOPe 2.08: Domain d2gdrc2: 2gdr C:81-202

Lineage for d2gdrc2 (2gdr C:81-202)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [225116] (2 PDB entries)

8. Domain d2gdrc2: 2gdr C:81-202 [204342]
   Other proteins in same PDB: d2gdra1, d2gdrb1, d2gdrc1, d2gdrd1, d2gdre1, d2gdrf1
   automated match to d1n2aa1
   complexed with gsh

Details for d2gdrc2

PDB Entry: 2gdr, 2.1 Å

PDB Description: Crystal structure of a bacterial glutathione transferase

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d2gdrc2:

Sequence; same for both SEQRES and ATOM records:

>d2gdrc2 a.45.1.0 (C:81-202) automated matches {Burkholderia xenovorans [TaxId: 266265]}
qlapangsferyhlqqwlnfisselhksfsplfnpassdewknavrqslntrlgqvarql
ehapyllgdqlsvadiylfvvlgwsayvnidlspwpslqafqgrvggreavqsalraegl
ik

Timeline for d2gdrc2:

• d2gdrc2 first appeared in SCOPe 2.03
  
• d2gdrc2 appears in SCOPe 2.07