Lineage for d2gdrd1 (2gdr D:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879334Species Burkholderia xenovorans [TaxId:266265] [225115] (2 PDB entries)
  8. 2879342Domain d2gdrd1: 2gdr D:1-80 [204343]
    Other proteins in same PDB: d2gdra2, d2gdrb2, d2gdrc2, d2gdrd2, d2gdre2, d2gdrf2
    automated match to d1n2aa2
    complexed with gsh

Details for d2gdrd1

PDB Entry: 2gdr (more details), 2.1 Å

PDB Description: Crystal structure of a bacterial glutathione transferase
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d2gdrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdrd1 c.47.1.0 (D:1-80) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mklyyspgacslsphialreaglnfelvqvdlaskktasgqdylevnpagyvpclqlddg
rtltegpaivqyvadqvpgk

SCOPe Domain Coordinates for d2gdrd1:

Click to download the PDB-style file with coordinates for d2gdrd1.
(The format of our PDB-style files is described here.)

Timeline for d2gdrd1: