SCOPe 2.04: Domain d2eixa2: 2eix A:151-281

Lineage for d2eixa2 (2eix A:151-281)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (15 species)
   not a true protein

7. Species Slime mold (Physarum polycephalum) [TaxId:5791] [225254] (1 PDB entry)

8. Domain d2eixa2: 2eix A:151-281 [204128]
   Other proteins in same PDB: d2eixa1, d2eixb1
   automated match to d1qx4a2
   complexed with fad, gol, iod, na

Details for d2eixa2

PDB Entry: 2eix, 1.56 Å

PDB Description: The Structure of Physarum polycephalum cytochrome b5 reductase

PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d2eixa2:

Sequence; same for both SEQRES and ATOM records:

>d2eixa2 c.25.1.0 (A:151-281) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]}
pnmvkemgmiaggtgitpmlqvaraiiknpkektiinlifanvneddillrtelddmakk
ysnfkvyyvlnnppagwtggvgfvsadmikqhfsppssdikvmmcgppmmnkamqghlet
lgytpeqwfif

Timeline for d2eixa2:

• d2eixa2 first appeared in SCOPe 2.03
  
• d2eixa2 appears in SCOPe 2.05
  
• d2eixa2 appears in the current release, SCOPe 2.08