SCOPe 2.04: Domain d2eixb1: 2eix B:39-150

Lineage for d2eixb1 (2eix B:39-150)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Slime mold (Physarum polycephalum) [TaxId:5791] [225253] (1 PDB entry)

8. Domain d2eixb1: 2eix B:39-150 [204129]
   Other proteins in same PDB: d2eixa2, d2eixb2
   automated match to d1i7pa1
   complexed with fad, gol, iod, na

Details for d2eixb1

PDB Entry: 2eix, 1.56 Å

PDB Description: The Structure of Physarum polycephalum cytochrome b5 reductase

PDB Compounds: (B:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d2eixb1:

Sequence; same for both SEQRES and ATOM records:

>d2eixb1 b.43.4.0 (B:39-150) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]}
krepalnpneykkfmlrekqiinhntrlfrfnlhhpedvvglpigqhmsvkatvdgkeiy
rpytpvssddekgyfdliikvyekgqmsqyidhlnpgdflqvrgpkgqfdyk

Timeline for d2eixb1:

• d2eixb1 first appeared in SCOPe 2.03
  
• d2eixb1 appears in SCOPe 2.05
  
• d2eixb1 appears in the current release, SCOPe 2.08