Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (16 species) not a true protein |
Species Slime mold (Physarum polycephalum) [TaxId:5791] [225253] (1 PDB entry) |
Domain d2eixa1: 2eix A:39-150 [204127] Other proteins in same PDB: d2eixa2, d2eixb2 automated match to d1i7pa1 complexed with fad, gol, iod, na |
PDB Entry: 2eix (more details), 1.56 Å
SCOPe Domain Sequences for d2eixa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eixa1 b.43.4.0 (A:39-150) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]} krepalnpneykkfmlrekqiinhntrlfrfnlhhpedvvglpigqhmsvkatvdgkeiy rpytpvssddekgyfdliikvyekgqmsqyidhlnpgdflqvrgpkgqfdyk
Timeline for d2eixa1: