Lineage for d2eixa1 (2eix A:39-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793796Species Slime mold (Physarum polycephalum) [TaxId:5791] [225253] (1 PDB entry)
  8. 2793797Domain d2eixa1: 2eix A:39-150 [204127]
    Other proteins in same PDB: d2eixa2, d2eixb2
    automated match to d1i7pa1
    complexed with fad, gol, iod, na

Details for d2eixa1

PDB Entry: 2eix (more details), 1.56 Å

PDB Description: The Structure of Physarum polycephalum cytochrome b5 reductase
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d2eixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eixa1 b.43.4.0 (A:39-150) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]}
krepalnpneykkfmlrekqiinhntrlfrfnlhhpedvvglpigqhmsvkatvdgkeiy
rpytpvssddekgyfdliikvyekgqmsqyidhlnpgdflqvrgpkgqfdyk

SCOPe Domain Coordinates for d2eixa1:

Click to download the PDB-style file with coordinates for d2eixa1.
(The format of our PDB-style files is described here.)

Timeline for d2eixa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eixa2