Lineage for d2cw2a1 (2cw2 A:2-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690520Species Perkinsus marinus [TaxId:31276] [225086] (2 PDB entries)
  8. 2690521Domain d2cw2a1: 2cw2 A:2-89 [203834]
    Other proteins in same PDB: d2cw2a2, d2cw2b2
    automated match to d1unfx1
    complexed with fe

Details for d2cw2a1

PDB Entry: 2cw2 (more details), 1.86 Å

PDB Description: crystal structure of superoxide dismutase from p. marinus
PDB Compounds: (A:) superoxide dismutase 1

SCOPe Domain Sequences for d2cw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw2a1 a.2.11.0 (A:2-89) automated matches {Perkinsus marinus [TaxId: 31276]}
svtgpfqcpplpyvknalephmsaetltyhhdkhhqtyvdtlnsiaaenstiasktleqi
iktetgkpfnqaaqvynhtfffnnlap

SCOPe Domain Coordinates for d2cw2a1:

Click to download the PDB-style file with coordinates for d2cw2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cw2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cw2a2