Lineage for d2cw2a2 (2cw2 A:90-201)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (34 species)
    not a true protein
  7. 2514115Species Perkinsus marinus [TaxId:31276] [225087] (2 PDB entries)
  8. 2514116Domain d2cw2a2: 2cw2 A:90-201 [203835]
    Other proteins in same PDB: d2cw2a1, d2cw2b1
    automated match to d1unfx2
    complexed with fe

Details for d2cw2a2

PDB Entry: 2cw2 (more details), 1.86 Å

PDB Description: crystal structure of superoxide dismutase from p. marinus
PDB Compounds: (A:) superoxide dismutase 1

SCOPe Domain Sequences for d2cw2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw2a2 d.44.1.0 (A:90-201) automated matches {Perkinsus marinus [TaxId: 31276]}
ngggeptgkiaelitrdfgsfekfkedfsaaavghfgsgwvwliaddgklkivqghdagn
piresktplmnidvwehayyidyrnaraqyvknywnlvnwdfvndnvakagi

SCOPe Domain Coordinates for d2cw2a2:

Click to download the PDB-style file with coordinates for d2cw2a2.
(The format of our PDB-style files is described here.)

Timeline for d2cw2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cw2a1