Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Perkinsus marinus [TaxId:31276] [225086] (2 PDB entries) |
Domain d2cw2b1: 2cw2 B:5-89 [203836] Other proteins in same PDB: d2cw2a2, d2cw2b2 automated match to d1unfx1 complexed with fe |
PDB Entry: 2cw2 (more details), 1.86 Å
SCOPe Domain Sequences for d2cw2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw2b1 a.2.11.0 (B:5-89) automated matches {Perkinsus marinus [TaxId: 31276]} gpfqcpplpyvknalephmsaetltyhhdkhhqtyvdtlnsiaaenstiasktleqiikt etgkpfnqaaqvynhtfffnnlap
Timeline for d2cw2b1: