Lineage for d1unfx1 (1unf X:14-104)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twistSuperfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) 
automatically mapped to Pfam PF00081Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) 
Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) 
Species Cowpea (Vigna unguiculata) [TaxId:3917] [116762] (1 PDB entry)
Uniprot Q9M7R2 21-245
Domain d1unfx1: 1unf X:14-104 [113314]
Other proteins in same PDB: d1unfx2
complexed with fe
Details for d1unfx1
PDB Entry: 1unf (more details), 1.97 Å
PDB Description: the crystal structure of the eukaryotic fesod from vigna unguiculata suggests a new enzymatic mechanism
PDB Compounds: (X:) iron superoxide dismutaseSCOPe Domain Sequences for d1unfx1:
Sequence, based on SEQRES records: (download)
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
kvnakfelkpppyplnglepvmsqqtlefhwgkhhrtyvenlkkqvvgteldgksleeii
vtaynkgdilpafnnaaqvwnhdffwecmkp
Sequence, based on observed residues (ATOM records): (download)
>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
kvnakfelkpppyplnglepvmsqqtlefhwgkhhrtyvenlkkqvteldgksleeiivt
aynkgdilpafnnaaqvwnhdffwecmkp
SCOPe Domain Coordinates for d1unfx1:
Click to download the PDB-style file with coordinates for d1unfx1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1unfx1:
- d1unfx1 first appeared in SCOP 1.71
- d1unfx1 appears in SCOPe 2.07
View in 3D
