Lineage for d2c0ib2 (2c0i B:121-223)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965473Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2965474Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2965501Domain d2c0ib2: 2c0i B:121-223 [203668]
    Other proteins in same PDB: d2c0ia1, d2c0ia3, d2c0ia4, d2c0ib1, d2c0ib3, d2c0ib4
    automated match to d1qcfa2
    complexed with ca, l1g

Details for d2c0ib2

PDB Entry: 2c0i (more details), 2.3 Å

PDB Description: src family kinase hck with bound inhibitor a-420983
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2c0ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ib2 d.93.1.1 (B:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d2c0ib2:

Click to download the PDB-style file with coordinates for d2c0ib2.
(The format of our PDB-style files is described here.)

Timeline for d2c0ib2: