![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein Hemopoetic cell kinase Hck [55565] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
![]() | Domain d2c0ia2: 2c0i A:121-223 [203665] Other proteins in same PDB: d2c0ia1, d2c0ia3, d2c0ia4, d2c0ib1, d2c0ib3, d2c0ib4 automated match to d1qcfa2 complexed with ca, l1g |
PDB Entry: 2c0i (more details), 2.3 Å
SCOPe Domain Sequences for d2c0ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ia2 d.93.1.1 (A:121-223) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d2c0ia2:
![]() Domains from other chains: (mouse over for more information) d2c0ib1, d2c0ib2, d2c0ib3, d2c0ib4 |