| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Hemapoetic cell kinase Hck [50062] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
| Domain d2c0ia1: 2c0i A:60-120 [203664] Other proteins in same PDB: d2c0ia2, d2c0ia3, d2c0ia4, d2c0ib2, d2c0ib3, d2c0ib4 automated match to d1qcfa1 complexed with ca, l1g |
PDB Entry: 2c0i (more details), 2.3 Å
SCOPe Domain Sequences for d2c0ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ia1 b.34.2.1 (A:60-120) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t
Timeline for d2c0ia1:
View in 3DDomains from other chains: (mouse over for more information) d2c0ib1, d2c0ib2, d2c0ib3, d2c0ib4 |