| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Hemopoetic cell kinase Hck [55565] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
| Domain d1qcfa2: 1qcf A:146-248 [40490] Other proteins in same PDB: d1qcfa1, d1qcfa3 complexed with pp1 |
PDB Entry: 1qcf (more details), 2 Å
SCOPe Domain Sequences for d1qcfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d1qcfa2: