SCOPe 2.08: Domain d2b0oh1: 2b0o H:424-543

Lineage for d2b0oh1 (2b0o H:424-543)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
   zinc-bound alpha+beta motif

4. Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families)

5. Family g.45.1.0: automated matches [227161] (1 protein)
   not a true family

6. Protein automated matches [226869] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225018] (1 PDB entry)

8. Domain d2b0oh1: 2b0o H:424-543 [203525]
   Other proteins in same PDB: d2b0oe2, d2b0of2, d2b0og2, d2b0oh2
   automated match to d1dcqa2
   complexed with zn

Details for d2b0oh1

PDB Entry: 2b0o, 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain

PDB Compounds: (H:) uplc1

SCOPe Domain Sequences for d2b0oh1:

Sequence; same for both SEQRES and ATOM records:

>d2b0oh1 g.45.1.0 (H:424-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqsltl
dllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrfarr

Timeline for d2b0oh1:

• d2b0oh1 first appeared in SCOPe 2.03
  
• d2b0oh1 appears in SCOPe 2.07