Lineage for d2b0of2 (2b0o F:545-697)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006665Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 3006666Protein automated matches [191267] (8 species)
    not a true protein
  7. 3006685Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)
  8. 3006703Domain d2b0of2: 2b0o F:545-697 [203522]
    Other proteins in same PDB: d2b0oe1, d2b0of1, d2b0og1, d2b0oh1
    automated match to d1dcqa1
    complexed with zn

Details for d2b0of2

PDB Entry: 2b0o (more details), 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain
PDB Compounds: (F:) uplc1

SCOPe Domain Sequences for d2b0of2:

Sequence, based on SEQRES records: (download)

>d2b0of2 d.211.1.0 (F:545-697) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpepqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeelvlhlavkvanqaslpl
vdfiiqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiark
khhkeceelleqaqagtfafplhvdyswviste

Sequence, based on observed residues (ATOM records): (download)

>d2b0of2 d.211.1.0 (F:545-697) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqng
ghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkecee
lleqaqagtfafplhvdyswviste

SCOPe Domain Coordinates for d2b0of2:

Click to download the PDB-style file with coordinates for d2b0of2.
(The format of our PDB-style files is described here.)

Timeline for d2b0of2: