SCOPe 2.08: Domain d2b0oh2: 2b0o H:547-694

Lineage for d2b0oh2 (2b0o H:547-694)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)

8. Domain d2b0oh2: 2b0o H:547-694 [203526]
   Other proteins in same PDB: d2b0oe1, d2b0of1, d2b0og1, d2b0oh1
   automated match to d1dcqa1
   complexed with zn

Details for d2b0oh2

PDB Entry: 2b0o, 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain

PDB Compounds: (H:) uplc1

SCOPe Domain Sequences for d2b0oh2:

Sequence, based on SEQRES records:

>d2b0oh2 d.211.1.0 (H:547-694) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeelvlhlavkvanqaslplvd
fiiqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkh
hkeceelleqaqagtfafplhvdyswvi

Sequence, based on observed residues (ATOM records):

>d2b0oh2 d.211.1.0 (H:547-694) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqng
ghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkecee
lleqaqagtfafplhvdyswvi

Timeline for d2b0oh2:

• d2b0oh2 first appeared in SCOPe 2.03
  
• d2b0oh2 appears in SCOPe 2.07