Lineage for d1dcqa2 (1dcq A:247-368)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
zinc-bound alpha+beta motifSuperfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) 
Family g.45.1.1: Pyk2-associated protein beta ARF-GAP domain [57864] (1 protein)
automatically mapped to Pfam PF01412Protein Pyk2-associated protein beta ARF-GAP domain [57865] (1 species)
core is similar to that of the RING finger but lacks one zinc-binding siteSpecies Mouse (Mus musculus) [TaxId:10090] [57866] (1 PDB entry) 
Domain d1dcqa2: 1dcq A:247-368 [45326]
Other proteins in same PDB: d1dcqa1
complexed with zn
Details for d1dcqa2
PDB Entry: 1dcq (more details), 2.1 Å
PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
PDB Compounds: (A:) pyk2-associated protein betaSCOPe Domain Sequences for d1dcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]}
ltkeiisevqrmtgndvccdcgapdptwlstnlgiltciecsgihrelgvhysrmqsltl
dvlgtselllaknignagfneimecclpsedpvkpnpgsdmiarkdyitakymerryark
kh
SCOPe Domain Coordinates for d1dcqa2:
Click to download the PDB-style file with coordinates for d1dcqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dcqa2:
- d1dcqa2 first appeared (with stable ids) in SCOP 1.55
- d1dcqa2 appears in SCOPe 2.07
View in 3D
