Lineage for d1dcqa2 (1dcq A:247-368)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.45: Pyk2-associated protein beta ARF-GAP domain [57862] (1 superfamily) Superfamily g.45.1: Pyk2-associated protein beta ARF-GAP domain [57863] (1 family) 
Family g.45.1.1: Pyk2-associated protein beta ARF-GAP domain [57864] (1 protein) Protein Pyk2-associated protein beta ARF-GAP domain [57865] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [57866] (1 PDB entry) 
Domain d1dcqa2: 1dcq A:247-368 [45326]
Other proteins in same PDB: d1dcqa1
Details for d1dcqa2
PDB Entry: 1dcq (more details), 2.1 Å
PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
SCOP Domain Sequences for d1dcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus)}
ltkeiisevqrmtgndvccdcgapdptwlstnlgiltciecsgihrelgvhysrmqsltl
dvlgtselllaknignagfneimecclpsedpvkpnpgsdmiarkdyitakymerryark
kh
SCOP Domain Coordinates for d1dcqa2:
Click to download the PDB-style file with coordinates for d1dcqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dcqa2:
- d1dcqa2 appears in SCOP 1.57
- d1dcqa2 appears in the current release, SCOPe 2.08
View in 3D
