Lineage for d2a03a2 (2a03 A:85-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946478Species Plasmodium berghei [TaxId:5821] [224987] (1 PDB entry)
  8. 2946479Domain d2a03a2: 2a03 A:85-197 [203381]
    Other proteins in same PDB: d2a03a1, d2a03b1
    automated match to d1dt0a2
    complexed with mn, zn

Details for d2a03a2

PDB Entry: 2a03 (more details), 2.33 Å

PDB Description: superoxide dismutase protein from plasmodium berghei
PDB Compounds: (A:) Fe-superoxide dismutase homolog

SCOPe Domain Sequences for d2a03a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a03a2 d.44.1.0 (A:85-197) automated matches {Plasmodium berghei [TaxId: 5821]}
cggephgeikekiqedfgsfnnfkdqfsnvlcghfgsgwgwlalnknnklvilqthdagn
pikentgipiltcdvwehayyidyrndrlsyvkawwnlvnwnfanenlknaln

SCOPe Domain Coordinates for d2a03a2:

Click to download the PDB-style file with coordinates for d2a03a2.
(The format of our PDB-style files is described here.)

Timeline for d2a03a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a03a1