![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Plasmodium berghei [TaxId:5821] [224987] (1 PDB entry) |
![]() | Domain d2a03b2: 2a03 B:85-197 [203383] Other proteins in same PDB: d2a03a1, d2a03b1 automated match to d1dt0a2 complexed with mn, zn |
PDB Entry: 2a03 (more details), 2.33 Å
SCOPe Domain Sequences for d2a03b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a03b2 d.44.1.0 (B:85-197) automated matches {Plasmodium berghei [TaxId: 5821]} cggephgeikekiqedfgsfnnfkdqfsnvlcghfgsgwgwlalnknnklvilqthdagn pikentgipiltcdvwehayyidyrndrlsyvkawwnlvnwnfanenlknaln
Timeline for d2a03b2: