SCOPe 2.03: Domain d2a03a2: 2a03 A:85-197

Lineage for d2a03a2 (2a03 A:85-197)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Plasmodium berghei [TaxId:5821] [224987] (1 PDB entry)

8. Domain d2a03a2: 2a03 A:85-197 [203381]
   Other proteins in same PDB: d2a03a1, d2a03b1
   automated match to d1dt0a2
   complexed with mn, zn

Details for d2a03a2

PDB Entry: 2a03, 2.33 Å

PDB Description: superoxide dismutase protein from plasmodium berghei

PDB Compounds: (A:) Fe-superoxide dismutase homolog

SCOPe Domain Sequences for d2a03a2:

Sequence; same for both SEQRES and ATOM records:

>d2a03a2 d.44.1.0 (A:85-197) automated matches {Plasmodium berghei [TaxId: 5821]}
cggephgeikekiqedfgsfnnfkdqfsnvlcghfgsgwgwlalnknnklvilqthdagn
pikentgipiltcdvwehayyidyrndrlsyvkawwnlvnwnfanenlknaln

Timeline for d2a03a2:

• d2a03a2 is new in SCOPe 2.03-stable
  
• d2a03a2 appears in SCOPe 2.04
  
• d2a03a2 appears in the current release, SCOPe 2.08