Lineage for d2a03b1 (2a03 B:1-84)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690525Species Plasmodium berghei [TaxId:5821] [224986] (1 PDB entry)
  8. 2690527Domain d2a03b1: 2a03 B:1-84 [203382]
    Other proteins in same PDB: d2a03a2, d2a03b2
    automated match to d1dt0a1
    complexed with mn, zn

Details for d2a03b1

PDB Entry: 2a03 (more details), 2.33 Å

PDB Description: superoxide dismutase protein from plasmodium berghei
PDB Compounds: (B:) Fe-superoxide dismutase homolog

SCOPe Domain Sequences for d2a03b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a03b1 a.2.11.0 (B:1-84) automated matches {Plasmodium berghei [TaxId: 5821]}
maitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanksltdilkes
tgaifnnaaqiwnhsfywdsmgpn

SCOPe Domain Coordinates for d2a03b1:

Click to download the PDB-style file with coordinates for d2a03b1.
(The format of our PDB-style files is described here.)

Timeline for d2a03b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a03b2