![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Plasmodium berghei [TaxId:5821] [224986] (1 PDB entry) |
![]() | Domain d2a03a1: 2a03 A:1-84 [203380] Other proteins in same PDB: d2a03a2, d2a03b2 automated match to d1dt0a1 complexed with mn, zn |
PDB Entry: 2a03 (more details), 2.33 Å
SCOPe Domain Sequences for d2a03a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a03a1 a.2.11.0 (A:1-84) automated matches {Plasmodium berghei [TaxId: 5821]} maitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanksltdilkes tgaifnnaaqiwnhsfywdsmgpn
Timeline for d2a03a1: