Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225008] (14 PDB entries) |
Domain d1zxma1: 1zxm A:29-265 [203366] Other proteins in same PDB: d1zxma2, d1zxmb2 automated match to d1pvgb2 complexed with anp, mg |
PDB Entry: 1zxm (more details), 1.87 Å
SCOPe Domain Sequences for d1zxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxma1 d.122.1.0 (A:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]} sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk
Timeline for d1zxma1: