Lineage for d1zxma1 (1zxm A:29-265)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537694Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2537695Protein automated matches [226867] (15 species)
    not a true protein
  7. 2537742Species Human (Homo sapiens) [TaxId:9606] [225008] (12 PDB entries)
  8. 2537745Domain d1zxma1: 1zxm A:29-265 [203366]
    Other proteins in same PDB: d1zxma2, d1zxmb2
    automated match to d1pvgb2
    complexed with anp, mg

Details for d1zxma1

PDB Entry: 1zxm (more details), 1.87 Å

PDB Description: Human Topo IIa ATPase/AMP-PNP
PDB Compounds: (A:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxma1 d.122.1.0 (A:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

SCOPe Domain Coordinates for d1zxma1:

Click to download the PDB-style file with coordinates for d1zxma1.
(The format of our PDB-style files is described here.)

Timeline for d1zxma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zxma2