Lineage for d1pvgb2 (1pvg B:8-245)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) 
Protein DNA topoisomerase II [103226] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103227] (3 PDB entries) 
Domain d1pvgb2: 1pvg B:8-245 [95164]
Other proteins in same PDB: d1pvga1, d1pvgb1
complexed with anp, mg
Details for d1pvgb2
PDB Entry: 1pvg (more details), 1.8 Å
PDB Description: crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
PDB Compounds: (B:) DNA topoisomerase IISCOPe Domain Sequences for d1pvgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvgb2 d.122.1.2 (B:8-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifdei
lvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllts
snydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkits
ykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkir
SCOPe Domain Coordinates for d1pvgb2:
Click to download the PDB-style file with coordinates for d1pvgb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pvgb2:
- d1pvgb2 first appeared in SCOP 1.67
- d1pvgb2 appears in SCOPe 2.06
- d1pvgb2 appears in the current release, SCOPe 2.08
View in 3D
