Lineage for d1pvga2 (1pvg A:7-245)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580324Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2580351Protein DNA topoisomerase II [103226] (1 species)
  7. 2580352Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103227] (3 PDB entries)
  8. 2580357Domain d1pvga2: 1pvg A:7-245 [95162]
    Other proteins in same PDB: d1pvga1, d1pvgb1
    complexed with anp, mg

Details for d1pvga2

PDB Entry: 1pvg (more details), 1.8 Å

PDB Description: crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii
PDB Compounds: (A:) DNA topoisomerase II

SCOPe Domain Sequences for d1pvga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sasdkyqkisqlehilkrpdtyigsvetqeqlqwiydeetdcmieknvtivpglfkifde
ilvnaadnkvrdpsmkridvnihaeehtievkndgkgipieihnkeniyipemifghllt
ssnydddekkvtggrngygaklcnifstefiletadlnvgqkyvqkwennmsichppkit
sykkgpsytkvtfkpdltrfgmkeldndilgvmrrrvydingsvrdinvylngkslkir

SCOPe Domain Coordinates for d1pvga2:

Click to download the PDB-style file with coordinates for d1pvga2.
(The format of our PDB-style files is described here.)

Timeline for d1pvga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvga1