Lineage for d1zxma2 (1zxm A:266-405)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538179Species Human (Homo sapiens) [TaxId:9606] [189350] (12 PDB entries)
  8. 2538180Domain d1zxma2: 1zxm A:266-405 [203367]
    Other proteins in same PDB: d1zxma1, d1zxmb1
    automated match to d1pvgb1
    complexed with anp, mg

Details for d1zxma2

PDB Entry: 1zxm (more details), 1.87 Å

PDB Description: Human Topo IIa ATPase/AMP-PNP
PDB Compounds: (A:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxma2:

Sequence, based on SEQRES records: (download)

>d1zxma2 d.14.1.0 (A:266-405) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp
ksfgstcqlsekfikaaigc

Sequence, based on observed residues (ATOM records): (download)

>d1zxma2 d.14.1.0 (A:266-405) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknavkahqvknhmwifvnalienptfdsqtkenmtlqpksfg
stcqlsekfikaaigc

SCOPe Domain Coordinates for d1zxma2:

Click to download the PDB-style file with coordinates for d1zxma2.
(The format of our PDB-style files is described here.)

Timeline for d1zxma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zxma1