Lineage for d1yx2a2 (1yx2 A:283-359)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544910Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 1544911Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 1544912Protein Glycine cleavage system T protein, GcvT [110231] (4 species)
  7. 1544913Species Bacillus subtilis [TaxId:1423] [224969] (1 PDB entry)
  8. 1544914Domain d1yx2a2: 1yx2 A:283-359 [203235]
    Other proteins in same PDB: d1yx2a1, d1yx2b1
    automated match to d1v5va1
    complexed with edo

Details for d1yx2a2

PDB Entry: 1yx2 (more details), 2.08 Å

PDB Description: Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1yx2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx2a2 b.44.2.1 (A:283-359) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]}
rklvglemiekgiprhgyevfqngksvgkvttgtqsptlgknvglalidsetseigtvvd
veirkklvkakvvktpf

SCOPe Domain Coordinates for d1yx2a2:

Click to download the PDB-style file with coordinates for d1yx2a2.
(The format of our PDB-style files is described here.)

Timeline for d1yx2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yx2a1