SCOPe 2.08: Domain d1yx2a2: 1yx2 A:283-359

Lineage for d1yx2a2 (1yx2 A:283-359)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)

6. Protein Glycine cleavage system T protein, GcvT [110231] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [224969] (1 PDB entry)

8. Domain d1yx2a2: 1yx2 A:283-359 [203235]
   Other proteins in same PDB: d1yx2a1, d1yx2b1
   automated match to d1v5va1
   complexed with edo

Details for d1yx2a2

PDB Entry: 1yx2, 2.08 Å

PDB Description: Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis

PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1yx2a2:

Sequence; same for both SEQRES and ATOM records:

>d1yx2a2 b.44.2.1 (A:283-359) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]}
rklvglemiekgiprhgyevfqngksvgkvttgtqsptlgknvglalidsetseigtvvd
veirkklvkakvvktpf

Timeline for d1yx2a2:

• d1yx2a2 first appeared in SCOPe 2.03
  
• d1yx2a2 appears in SCOPe 2.07