Lineage for d1yx2b1 (1yx2 B:1-282)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1687543Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 1687544Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 1687545Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 1687546Protein Glycine cleavage system T protein, GcvT [111012] (4 species)
  7. 1687547Species Bacillus subtilis [TaxId:1423] [224968] (1 PDB entry)
  8. 1687549Domain d1yx2b1: 1yx2 B:1-282 [203236]
    Other proteins in same PDB: d1yx2a2, d1yx2b2
    automated match to d1v5va2
    complexed with edo

Details for d1yx2b1

PDB Entry: 1yx2 (more details), 2.08 Å

PDB Description: Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
PDB Compounds: (B:) Aminomethyltransferase

SCOPe Domain Sequences for d1yx2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yx2b1 d.250.1.1 (B:1-282) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]}
mlkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgn
dslsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkd
lawmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadisgr
kalisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeaniply
gqeltrditpieagigfavkhkkesdffgksvlseqkengak

SCOPe Domain Coordinates for d1yx2b1:

Click to download the PDB-style file with coordinates for d1yx2b1.
(The format of our PDB-style files is described here.)

Timeline for d1yx2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yx2b2