| Class b: All beta proteins [48724] (174 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) ![]() |
| Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) |
| Protein Glycine cleavage system T protein, GcvT [110231] (4 species) |
| Species Bacillus subtilis [TaxId:1423] [224969] (1 PDB entry) |
| Domain d1yx2a2: 1yx2 A:283-359 [203235] Other proteins in same PDB: d1yx2a1, d1yx2b1 automated match to d1v5va1 complexed with edo |
PDB Entry: 1yx2 (more details), 2.08 Å
SCOPe Domain Sequences for d1yx2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yx2a2 b.44.2.1 (A:283-359) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]}
rklvglemiekgiprhgyevfqngksvgkvttgtqsptlgknvglalidsetseigtvvd
veirkklvkakvvktpf
Timeline for d1yx2a2: