![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries) |
![]() | Domain d1xreb1: 1xre B:3-92 [203157] Other proteins in same PDB: d1xrea2, d1xreb2 automated match to d1jr9a1 complexed with mn |
PDB Entry: 1xre (more details), 1.8 Å
SCOPe Domain Sequences for d1xreb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xreb1 a.2.11.0 (B:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} sfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselhnksleellcnl etlpkeivtavrnnggghychslfwevmsp
Timeline for d1xreb1: