SCOPe 2.08: Domain d1xreb2: 1xre B:93-203

Lineage for d1xreb2 (1xre B:93-203)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224994] (2 PDB entries)

8. Domain d1xreb2: 1xre B:93-203 [203158]
   Other proteins in same PDB: d1xrea1, d1xreb1
   automated match to d1jr9a2
   complexed with mn

Details for d1xreb2

PDB Entry: 1xre, 1.8 Å

PDB Description: Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1xreb2:

Sequence; same for both SEQRES and ATOM records:

>d1xreb2 d.44.1.0 (B:93-203) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
rgggepngdvakvidyyfntfdnlkdqlskaaisrfgsgygwlvldgeelsvmstpnqdt
plqegkipllvidvwehayylkyqnrrpefvtnwwhtvnwdrvnekylqai

Timeline for d1xreb2:

• d1xreb2 first appeared in SCOPe 2.03
  
• d1xreb2 appears in SCOPe 2.07