Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
Protein automated matches [226879] (8 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225063] (1 PDB entry) |
Domain d1x1ob2: 1x1o B:117-286 [203074] Other proteins in same PDB: d1x1oa1, d1x1ob1, d1x1oc1 automated match to d1qapa1 |
PDB Entry: 1x1o (more details), 1.9 Å
SCOPe Domain Sequences for d1x1ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ob2 c.1.17.0 (B:117-286) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} iatltrayvealagtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhv raaggvgeavrrakaraphylkvevevrsleeleealeagadlilldnfplealreavrr vggrvpleasgnmtlerakaaaeagvdyvsvgalthsakaldlsllvvrp
Timeline for d1x1ob2:
View in 3D Domains from other chains: (mouse over for more information) d1x1oa1, d1x1oa2, d1x1oc1, d1x1oc2 |