Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) |
Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
Protein automated matches [226878] (11 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225062] (1 PDB entry) |
Domain d1x1ob1: 1x1o B:11-116 [203073] Other proteins in same PDB: d1x1oa2, d1x1ob2, d1x1oc2 automated match to d1qapa2 |
PDB Entry: 1x1o (more details), 1.9 Å
SCOPe Domain Sequences for d1x1ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1ob1 d.41.2.0 (B:11-116) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} qggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfaladp rtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsg
Timeline for d1x1ob1:
View in 3D Domains from other chains: (mouse over for more information) d1x1oa1, d1x1oa2, d1x1oc1, d1x1oc2 |