PDB entry 1x1o

View 1x1o on RCSB PDB site
Description: Crystal structure of project ID TT0268 from Thermus thermophilus HB8
Class: transferase
Keywords: TRANSFERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-04-08, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1oa1, d1x1oa2
  • Chain 'B':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1ob1, d1x1ob2
  • Chain 'C':
    Compound: Nicotinate-nucleotide pyrophosphorylase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1oc1, d1x1oc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1oA (A:)
    mggvvgealwqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwv
    aervfaladprtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatl
    trayvealagtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhvraag
    gvgeavrrakaraphylkvevevrsleeleealeagadlilldnfplealreavrrvggr
    vpleasgnmtlerakaaaeagvdyvsvgalthsakaldlsllvvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1oA (A:)
    wqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfalad
    prtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatltrayveala
    gtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhvraaggvgeavrra
    karaphylkvevevrsleeleealeagadlilldnfplealreavrrvggrvpleasgnm
    tlerakaaaeagvdyvsvgalthsakaldlsllvvrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x1oB (B:)
    mggvvgealwqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwv
    aervfaladprtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatl
    trayvealagtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhvraag
    gvgeavrrakaraphylkvevevrsleeleealeagadlilldnfplealreavrrvggr
    vpleasgnmtlerakaaaeagvdyvsvgalthsakaldlsllvvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1oB (B:)
    qggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfaladp
    rtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatltrayvealag
    tkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhvraaggvgeavrrak
    araphylkvevevrsleeleealeagadlilldnfplealreavrrvggrvpleasgnmt
    lerakaaaeagvdyvsvgalthsakaldlsllvvrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x1oC (C:)
    mggvvgealwqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwv
    aervfaladprtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatl
    trayvealagtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhvraag
    gvgeavrrakaraphylkvevevrsleeleealeagadlilldnfplealreavrrvggr
    vpleasgnmtlerakaaaeagvdyvsvgalthsakaldlsllvvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1oC (C:)
    wqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfalad
    prtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsgiatltrayveala
    gtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhvraaggvgeavrra
    karaphylkvevevrsleeleealeagadlilldnfplealreavrrvggrvpleasgnm
    tlerakaaaeagvdyvsvgalthsakaldlsllvvrp