SCOPe 2.08: Domain d1x1oc1: 1x1o C:10-116

Lineage for d1x1oc1 (1x1o C:10-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (11 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225062] (1 PDB entry)

8. Domain d1x1oc1: 1x1o C:10-116 [203075]
   Other proteins in same PDB: d1x1oa2, d1x1ob2, d1x1oc2
   automated match to d1qapa2

Details for d1x1oc1

PDB Entry: 1x1o, 1.9 Å

PDB Description: Crystal structure of project ID TT0268 from Thermus thermophilus HB8

PDB Compounds: (C:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d1x1oc1:

Sequence; same for both SEQRES and ATOM records:

>d1x1oc1 d.41.2.0 (C:10-116) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
wqggleealrawlredlgqgdltsllvvpedlegeavilakeggvlaglwvaervfalad
prtaftplvaegarvaegtevarvrgplrgilagerlalnllqrlsg

Timeline for d1x1oc1:

• d1x1oc1 first appeared in SCOPe 2.03
  
• d1x1oc1 appears in SCOPe 2.07