SCOPe 2.08: Domain d1x1oa2: 1x1o A:117-286

Lineage for d1x1oa2 (1x1o A:117-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (8 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225063] (1 PDB entry)

8. Domain d1x1oa2: 1x1o A:117-286 [203072]
   Other proteins in same PDB: d1x1oa1, d1x1ob1, d1x1oc1
   automated match to d1qapa1

Details for d1x1oa2

PDB Entry: 1x1o, 1.9 Å

PDB Description: Crystal structure of project ID TT0268 from Thermus thermophilus HB8

PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d1x1oa2:

Sequence; same for both SEQRES and ATOM records:

>d1x1oa2 c.1.17.0 (A:117-286) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
iatltrayvealagtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhv
raaggvgeavrrakaraphylkvevevrsleeleealeagadlilldnfplealreavrr
vggrvpleasgnmtlerakaaaeagvdyvsvgalthsakaldlsllvvrp

Timeline for d1x1oa2:

• d1x1oa2 first appeared in SCOPe 2.03
  
• d1x1oa2 appears in SCOPe 2.07