Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Diels alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries) |
Domain d1a4jl1: 1a4j L:1-112 [20230] Other proteins in same PDB: d1a4ja2, d1a4jb2, d1a4jh2, d1a4jl2 |
PDB Entry: 1a4j (more details), 2.1 Å
SCOP Domain Sequences for d1a4jl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4jl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab (mouse), kappa L chain} elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpptfgggtkleik
Timeline for d1a4jl1: