Lineage for d4fm4f_ (4fm4 F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393481Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries)
  8. 2393484Domain d4fm4f_: 4fm4 F: [202051]
    Other proteins in same PDB: d4fm4a_, d4fm4c_, d4fm4e_, d4fm4g_, d4fm4i_, d4fm4k_, d4fm4m_, d4fm4o_
    automated match to d4fm4j_
    complexed with fe, po4

Details for d4fm4f_

PDB Entry: 4fm4 (more details), 2.38 Å

PDB Description: Wild Type Fe-type Nitrile Hydratase from Comamonas testosteroni Ni1
PDB Compounds: (F:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d4fm4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fm4f_ b.34.4.0 (F:) automated matches {Comamonas testosteroni [TaxId: 285]}
mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk
lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
kdlwpdgceaadvhvgvfqsyllsae

SCOPe Domain Coordinates for d4fm4f_:

Click to download the PDB-style file with coordinates for d4fm4f_.
(The format of our PDB-style files is described here.)

Timeline for d4fm4f_: