![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
![]() | Protein automated matches [191237] (8 species) not a true protein |
![]() | Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries) |
![]() | Domain d4fm4f_: 4fm4 F: [202051] Other proteins in same PDB: d4fm4a_, d4fm4c_, d4fm4e_, d4fm4g_, d4fm4i_, d4fm4k_, d4fm4m_, d4fm4o_ automated match to d4fm4j_ complexed with fe, po4 |
PDB Entry: 4fm4 (more details), 2.38 Å
SCOPe Domain Sequences for d4fm4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fm4f_ b.34.4.0 (F:) automated matches {Comamonas testosteroni [TaxId: 285]} mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks kdlwpdgceaadvhvgvfqsyllsae
Timeline for d4fm4f_: