Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein automated matches [190085] (59 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [195628] (1 PDB entry) |
Domain d4e6pa_: 4e6p A: [201808] automated match to d4e6pb_ complexed with edo, na |
PDB Entry: 4e6p (more details), 2.1 Å
SCOPe Domain Sequences for d4e6pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e6pa_ c.2.1.2 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd yivsqtynvdggnwms
Timeline for d4e6pa_: