SCOPe 2.08: Domain d4e6pd_: 4e6p D:

Lineage for d4e6pd_ (4e6p D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [195628] (1 PDB entry)

8. Domain d4e6pd_: 4e6p D: [195630]
   automated match to d1k2wa_
   complexed with edo, na

Details for d4e6pd_

PDB Entry: 4e6p, 2.1 Å

PDB Description: Crystal structure of a probable sorbitol dehydrogenase (Target PSI-012078) from Sinorhizobium meliloti 1021

PDB Compounds: (D:) Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)

SCOPe Domain Sequences for d4e6pd_:

Sequence; same for both SEQRES and ATOM records:

>d4e6pd_ c.2.1.2 (D:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv
trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa
aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai
apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd
yivsqtynvdggnwms

Timeline for d4e6pd_:

• d4e6pd_ first appeared in SCOPe 2.02
  
• d4e6pd_ appears in SCOPe 2.07