PDB entry 4e6p

View 4e6p on RCSB PDB site
Description: Crystal structure of a probable sorbitol dehydrogenase (Target PSI-012078) from Sinorhizobium meliloti 1021
Class: oxidoreductase
Keywords: NAD(P)-binding, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium (NYSGRC), OXIDOREDUCTASE
Deposited on 2012-03-15, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.163
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: smoS, R02441, SMc01500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e6pa_
  • Chain 'B':
    Compound: Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: smoS, R02441, SMc01500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e6pb_
  • Chain 'C':
    Compound: Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: smoS, R02441, SMc01500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e6pc_
  • Chain 'D':
    Compound: Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: smoS, R02441, SMc01500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e6pd_
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e6pA (A:)
    smmkrlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavq
    mdvtrqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlft
    lqaaarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinv
    naiapgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasa
    esdyivsqtynvdggnwms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6pA (A:)
    krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv
    trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa
    aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai
    apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd
    yivsqtynvdggnwms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e6pB (B:)
    smmkrlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavq
    mdvtrqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlft
    lqaaarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinv
    naiapgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasa
    esdyivsqtynvdggnwms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6pB (B:)
    krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv
    trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa
    aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai
    apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd
    yivsqtynvdggnwms
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e6pC (C:)
    smmkrlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavq
    mdvtrqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlft
    lqaaarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinv
    naiapgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasa
    esdyivsqtynvdggnwms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6pC (C:)
    krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv
    trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa
    aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai
    apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd
    yivsqtynvdggnwms
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e6pD (D:)
    smmkrlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavq
    mdvtrqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlft
    lqaaarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinv
    naiapgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasa
    esdyivsqtynvdggnwms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6pD (D:)
    krlegksalitgsargigrafaeayvregatvaiadidierarqaaaeigpaayavqmdv
    trqdsidaaiaatvehaggldilvnnaalfdlapiveitresyeklfainvagtlftlqa
    aarqmiaqgrggkiinmasqagrrgealvaiycatkaavisltqsagldlikhrinvnai
    apgvvdgehwdgvdalfaryenrprgekkrlvgeavpfgrmgtaedltgmaiflasaesd
    yivsqtynvdggnwms