Lineage for d4dhjc_ (4dhj C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939083Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)
  8. 2939096Domain d4dhjc_: 4dhj C: [201702]
    Other proteins in same PDB: d4dhja_, d4dhjb_, d4dhjd_, d4dhje_, d4dhjf_, d4dhjh_, d4dhji_, d4dhjj_, d4dhjl_, d4dhjm_
    automated match to d1j7db_

Details for d4dhjc_

PDB Entry: 4dhj (more details), 2.35 Å

PDB Description: the structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4dhjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhjc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnn

SCOPe Domain Coordinates for d4dhjc_:

Click to download the PDB-style file with coordinates for d4dhjc_.
(The format of our PDB-style files is described here.)

Timeline for d4dhjc_: