![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries) |
![]() | Domain d4dhjk_: 4dhj K: [196008] Other proteins in same PDB: d4dhja_, d4dhjb_, d4dhjd_, d4dhje_, d4dhjf_, d4dhjh_, d4dhji_, d4dhjj_, d4dhjl_, d4dhjm_ automated match to d2c2vb_ |
PDB Entry: 4dhj (more details), 2.35 Å
SCOPe Domain Sequences for d4dhjk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhjk_ d.20.1.1 (K:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla ndvaeqwktneaqaietarawtrlyamn
Timeline for d4dhjk_: