Lineage for d4dhjk_ (4dhj K:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2507738Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2507829Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (8 PDB entries)
  8. 2507835Domain d4dhjk_: 4dhj K: [196008]
    Other proteins in same PDB: d4dhja_, d4dhjb_, d4dhjd_, d4dhje_, d4dhjf_, d4dhjh_, d4dhji_, d4dhjj_, d4dhjl_, d4dhjm_
    automated match to d2c2vb_

Details for d4dhjk_

PDB Entry: 4dhj (more details), 2.35 Å

PDB Description: the structure of a ceotub1 ubiquitin aldehyde ubc13~ub complex
PDB Compounds: (K:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4dhjk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhjk_ d.20.1.1 (K:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamn

SCOPe Domain Coordinates for d4dhjk_:

Click to download the PDB-style file with coordinates for d4dhjk_.
(The format of our PDB-style files is described here.)

Timeline for d4dhjk_: